I have a python script that generates an image for the protein domains using dna_feature_viewer and works fine. I am working with flask and want to display this image in a webpage.
I attach below the script:
@app.route('/image' )
def image():
d={'domain1': ['4-50'], 'domain2': ['70-100']}
from Bio import SeqIO
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio.Alphabet import generic_protein
from Bio.SeqFeature import SeqFeature, FeatureLocation
from dna_features_viewer import BiopythonTranslator
myseq='''MNEGFSEGEMETDRRTCSQQALHKDVEGKERRCQTCRSHLWLVALGLVLLSLTLCIFSLKYFWSPGPRKVYKHQYKVLLD
GVEMDSVMEIDPNRLMEMFKVGNGSDEVLEVHDFKNGLTGI'''
sequence_object = Seq(myseq, generic_protein)
# Create a record
record = SeqRecord(sequence_object,
id='123456789',
name='Example',
description='An example ')
for keys, values in d.items():
for i in range(len(values)):
value_split_START=int(values[i].split('-')[0])
value_split_END=int(values[i].split('-')[1])
feature = SeqFeature(FeatureLocation(start=value_split_START, end=value_split_END),
type=keys)
record.features.append(feature)
graphic_record = BiopythonTranslator().translate_record(record)
ax, _ = graphic_record.plot(figure_width=10, strand_in_label_threshold=7)
image_filename=ax.figure.savefig("static/images/image.png")
return render_template("image.html", imageout=image_filename)
Script 2. Html script
<img src="{{url_for('static', filename=image_filename )}}" />
While running the flask script, it stops and shows the following error:
WARNING: NSWindow drag regions should only be invalidated on the Main Thread! This will throw an exception in the future. Called from (
0 AppKit 0x00007fff292cf607 -[NSWindow(NSWindow_Theme) _postWindowNeedsToResetDragMarginsUnlessPostingDisabled] + 378
1 AppKit 0x00007fff292cc9f7 -[NSWindow _initContent:styleMask:backing:defer:contentView:] + 1479
2 AppKit 0x00007fff292cc42a -[NSWindow initWithContentRect:styleMask:backing:defer:] + 45
3 _macosx.cpython-37m-darwin.so 0x00000001233d283e -[Window initWithContentRect:styleMask:backing:defer:withManager:] + 94
4 _macosx.cpython-37m-darwin.so 0x00000001233d6745 FigureManager_init + 341
5 python 0x000000010ed985ac wrap_init + 12
6 python 0x000000010ed2255e wrapperdescr_call + 254
7 python 0x000000010ed16ae3 _PyObject_FastCallKeywords + 179
8 python 0x000000010ee53ed5 call_function + 453
9 python 0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
10 python 0x000000010ed168d5 function_code_fastcall + 117
11 python 0x000000010ed98381 slot_tp_init + 193
12 python 0x000000010eda2361 type_call + 241
13 python 0x000000010ed16ae3 _PyObject_FastCallKeywords + 179
14 python 0x000000010ee53ed5 call_function + 453
15 python 0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
16 python 0x000000010ed168d5 function_code_fastcall + 117
17 python 0x000000010ee53dc7 call_function + 183
18 python 0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
19 python 0x000000010ee4549e _PyEval_EvalCodeWithName + 414
20 python 0x000000010ed15de7 _PyFunction_FastCallDict + 231
21 python 0x000000010ed19ce2 method_call + 130
22 python 0x000000010ed17752 PyObject_Call + 130
23 python 0x000000010ee51d58 _PyEval_EvalFrameDefault + 46712
24 python 0x000000010ee4549e _PyEval_EvalCodeWithName + 414
25 python 0x000000010ed15de7 _PyFunction_FastCallDict + 231
26 python 0x000000010ee51d58 _PyEval_EvalFrameDefault + 46712
27 python 0x000000010ee4549e _PyEval_EvalCodeWithName + 414
28 python 0x000000010ed16fe3 _PyFunction_FastCallKeywords + 195
29 python 0x000000010ee53dc7 call_function + 183
30 python 0x000000010ee51be0 _PyEval_EvalFrameDefault + 46336
31 python 0x000000010ee4549e _PyEval_EvalCodeWithName + 414
32 python 0x000000010ed16fe3 _PyFunction_FastCallKeywords + 195
33 python 0x000000010ee53dc7 call_function + 183
34 python 0x000000010ee51be0 _PyEval_EvalFrameDefault + 46336
35 python 0x000000010ee4549e _PyEval_EvalCodeWithName + 414
36 python 0x000000010ed15de7 _PyFunction_FastCallDict + 231
37 python 0x000000010ee51d58 _PyEval_EvalFrameDefault + 46712
38 python 0x000000010ed168d5 function_code_fastcall + 117
39 python 0x000000010ee53dc7 call_function + 183
40 python 0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
41 python 0x000000010ed168d5 function_code_fastcall + 117
42 python 0x000000010ee53dc7 call_function + 183
43 python 0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
44 python 0x000000010ed168d5 function_code_fastcall + 117
45 python 0x000000010ee53dc7 call_function + 183
46 python 0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
47 python 0x000000010ed168d5 function_code_fastcall + 117
48 python 0x000000010ed9646d slot_tp_call + 189
49 python 0x000000010ed16ae3 _PyObject_FastCallKeywords + 179
50 python 0x000000010ee53ed5 call_function + 453
51 python 0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
52 python 0x000000010ed2fe49 gen_send_ex + 169
53 python 0x000000010ee50c83 _PyEval_EvalFrameDefault + 42403
54 python 0x000000010ee4549e _PyEval_EvalCodeWithName + 414
55 python 0x000000010ed16fe3 _PyFunction_FastCallKeywords + 195
56 python 0x000000010ee53dc7 call_function + 183
57 python 0x000000010ee51b27 _PyEval_EvalFrameDefault + 46151
58 python 0x000000010ee4549e _PyEval_EvalCodeWithName + 414
59 python 0x000000010ed16fe3 _PyFunction_FastCallKeywords + 195
60 python 0x000000010ee53dc7 call_function + 183
61 python 0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
62 python 0x000000010ed168d5 function_code_fastcall + 117
63 python 0x000000010ee53dc7 call_function + 183
64 python 0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
65 python 0x000000010ed168d5 function_code_fastcall + 117
66 python 0x000000010ee53dc7 call_function + 183
67 python 0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
68 python 0x000000010ed168d5 function_code_fastcall + 117
69 python 0x000000010ee53dc7 call_function + 183
70 python 0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
71 python 0x000000010ed168d5 function_code_fastcall + 117
72 python 0x000000010ed98381 slot_tp_init + 193
73 python 0x000000010eda2361 type_call + 241
74 python 0x000000010ed16ae3 _PyObject_FastCallKeywords + 179
75 python 0x000000010ee53ed5 call_function + 453
76 python 0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
77 python 0x000000010ed168d5 function_code_fastcall + 117
78 python 0x000000010ee53dc7 call_function + 183
79 python 0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
80 python 0x000000010ed168d5 function_code_fastcall + 117
81 python 0x000000010ed19ce2 method_call + 130
82 python 0x000000010ed17752 PyObject_Call + 130
83 python 0x000000010ee51d58 _PyEval_EvalFrameDefault + 46712
84 python 0x000000010ed168d5 function_code_fastcall + 117
85 python 0x000000010ee53dc7 call_function + 183
86 python 0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
87 python 0x000000010ed168d5 function_code_fastcall + 117
88 python 0x000000010ee53dc7 call_function + 183
89 python 0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
90 python 0x000000010ed168d5 function_code_fastcall + 117
91 python 0x000000010ed19ce2 method_call + 130
92 python 0x000000010ed17752 PyObject_Call + 130
93 python 0x000000010ef358cb t_bootstrap + 123
94 python 0x000000010eebc707 pythread_wrapper + 39
95 libsystem_pthread.dylib 0x00007fff57da22eb _pthread_body + 126
96 libsystem_pthread.dylib 0x00007fff57da5249 _pthread_start + 66
97 libsystem_pthread.dylib 0x00007fff57da140d thread_start + 13
)127.0.0.1 - - [05/Aug/2020 13:46:32] " /image HTTP/1.1" 200 - Assertion failed: (NSViewIsCurrentlyBuildingLayerTreeForDisplay(),= currentlyBuildingLayerTree), function NSViewSetCurrentlyBuildingLayerTreeForDisplay. file /BuildRoot/Library/Caches/com.apple.xbs/Sources/AppKit/AppKit-1671.60.107/AppKit.subproj/NSView,m. line 14221.
I am out of ideas why this is happening. I will be very grateful for any help. Thanks!
I was unable to re-create this exception, so I assume it may be something specific to your environment.
I tested this in the official python
docker image, running within Docker Desktop on OSX.
That said, there are some issues with your flask code which I'll cover here. Towards the end of your image
function you should probably be doing something more like:
# ....
ax, _ = graphic_record.plot(figure_width=10, strand_in_label_threshold=7)
# This bit changes...
output_filename = "image.png"
output_path = os.path.join('static', output_filename)
# The return value of this is not a filename
image = ax.figure.savefig(output_path)
# You should actually be passing `output_filename` to the template
return render_template("image.html", image_filename=output_filename)
Notice here:
output_filename
is the actual filename you want to save the image as output_path
is the full path static/image.png
. This is only used by the savefig
method to actually save the file to disk.output_filename
to the template as the image_filename
argument which then becomes available in the template.The template code looks like:
<img src="{{url_for('static', filename=image_filename )}}" />
Which in turn will generate the HTML:
<img src="/static/image.png" />
The technical post webpages of this site follow the CC BY-SA 4.0 protocol. If you need to reprint, please indicate the site URL or the original address.Any question please contact:yoyou2525@163.com.