简体   繁体   中英

Rendering a matplotlib image into flask

I have a python script that generates an image for the protein domains using dna_feature_viewer and works fine. I am working with flask and want to display this image in a webpage. 在此处输入图像描述

I attach below the script:

@app.route('/image' )  
def image():
 d={'domain1': ['4-50'], 'domain2': ['70-100']}
 from Bio import SeqIO
 from Bio.Seq import Seq
 from Bio.SeqRecord import SeqRecord
 from Bio.Alphabet import generic_protein
 from Bio.SeqFeature import SeqFeature, FeatureLocation
 from dna_features_viewer import BiopythonTranslator

 myseq='''MNEGFSEGEMETDRRTCSQQALHKDVEGKERRCQTCRSHLWLVALGLVLLSLTLCIFSLKYFWSPGPRKVYKHQYKVLLD
  GVEMDSVMEIDPNRLMEMFKVGNGSDEVLEVHDFKNGLTGI'''

 sequence_object = Seq(myseq, generic_protein)

 # Create a record
 record = SeqRecord(sequence_object,
               id='123456789', 
               name='Example',
               description='An example ')

 for keys, values in d.items():
   for i in range(len(values)):
      value_split_START=int(values[i].split('-')[0])
      value_split_END=int(values[i].split('-')[1])
      feature = SeqFeature(FeatureLocation(start=value_split_START, end=value_split_END), 
      type=keys)
      record.features.append(feature)


 graphic_record = BiopythonTranslator().translate_record(record)
 ax, _ = graphic_record.plot(figure_width=10, strand_in_label_threshold=7)
 
 image_filename=ax.figure.savefig("static/images/image.png")
 return render_template("image.html", imageout=image_filename)

Script 2. Html script

<img src="{{url_for('static', filename=image_filename )}}" />
   

While running the flask script, it stops and shows the following error:

WARNING: NSWindow drag regions should only be invalidated on the Main Thread! This will throw an exception in the future. Called from (
0   AppKit                              0x00007fff292cf607 -[NSWindow(NSWindow_Theme) _postWindowNeedsToResetDragMarginsUnlessPostingDisabled] + 378
1   AppKit                              0x00007fff292cc9f7 -[NSWindow _initContent:styleMask:backing:defer:contentView:] + 1479
2   AppKit                              0x00007fff292cc42a -[NSWindow initWithContentRect:styleMask:backing:defer:] + 45
3   _macosx.cpython-37m-darwin.so       0x00000001233d283e -[Window initWithContentRect:styleMask:backing:defer:withManager:] + 94
4   _macosx.cpython-37m-darwin.so       0x00000001233d6745 FigureManager_init + 341
5   python                              0x000000010ed985ac wrap_init + 12
6   python                              0x000000010ed2255e wrapperdescr_call + 254
7   python                              0x000000010ed16ae3 _PyObject_FastCallKeywords + 179
8   python                              0x000000010ee53ed5 call_function + 453
9   python                              0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
10  python                              0x000000010ed168d5 function_code_fastcall + 117
11  python                              0x000000010ed98381 slot_tp_init + 193
12  python                              0x000000010eda2361 type_call + 241
13  python                              0x000000010ed16ae3 _PyObject_FastCallKeywords + 179
14  python                              0x000000010ee53ed5 call_function + 453
15  python                              0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
16  python                              0x000000010ed168d5 function_code_fastcall + 117
17  python                              0x000000010ee53dc7 call_function + 183
18  python                              0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
19  python                              0x000000010ee4549e _PyEval_EvalCodeWithName + 414
20  python                              0x000000010ed15de7 _PyFunction_FastCallDict + 231
21  python                              0x000000010ed19ce2 method_call + 130
22  python                              0x000000010ed17752 PyObject_Call + 130
23  python                              0x000000010ee51d58 _PyEval_EvalFrameDefault + 46712
24  python                              0x000000010ee4549e _PyEval_EvalCodeWithName + 414
25  python                              0x000000010ed15de7 _PyFunction_FastCallDict + 231
26  python                              0x000000010ee51d58 _PyEval_EvalFrameDefault + 46712
27  python                              0x000000010ee4549e _PyEval_EvalCodeWithName + 414
28  python                              0x000000010ed16fe3 _PyFunction_FastCallKeywords + 195
29  python                              0x000000010ee53dc7 call_function + 183
30  python                              0x000000010ee51be0 _PyEval_EvalFrameDefault + 46336
31  python                              0x000000010ee4549e _PyEval_EvalCodeWithName + 414
32  python                              0x000000010ed16fe3 _PyFunction_FastCallKeywords + 195
33  python                              0x000000010ee53dc7 call_function + 183
34  python                              0x000000010ee51be0 _PyEval_EvalFrameDefault + 46336
35  python                              0x000000010ee4549e _PyEval_EvalCodeWithName + 414
36  python                              0x000000010ed15de7 _PyFunction_FastCallDict + 231
37  python                              0x000000010ee51d58 _PyEval_EvalFrameDefault + 46712
38  python                              0x000000010ed168d5 function_code_fastcall + 117
39  python                              0x000000010ee53dc7 call_function + 183
40  python                              0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
41  python                              0x000000010ed168d5 function_code_fastcall + 117
42  python                              0x000000010ee53dc7 call_function + 183
43  python                              0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
44  python                              0x000000010ed168d5 function_code_fastcall + 117
45  python                              0x000000010ee53dc7 call_function + 183
46  python                              0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
47  python                              0x000000010ed168d5 function_code_fastcall + 117
48  python                              0x000000010ed9646d slot_tp_call + 189
49  python                              0x000000010ed16ae3 _PyObject_FastCallKeywords + 179
50  python                              0x000000010ee53ed5 call_function + 453
51  python                              0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
52  python                              0x000000010ed2fe49 gen_send_ex + 169
53  python                              0x000000010ee50c83 _PyEval_EvalFrameDefault + 42403
54  python                              0x000000010ee4549e _PyEval_EvalCodeWithName + 414
55  python                              0x000000010ed16fe3 _PyFunction_FastCallKeywords + 195
56  python                              0x000000010ee53dc7 call_function + 183
57  python                              0x000000010ee51b27 _PyEval_EvalFrameDefault + 46151
58  python                              0x000000010ee4549e _PyEval_EvalCodeWithName + 414
59  python                              0x000000010ed16fe3 _PyFunction_FastCallKeywords + 195
60  python                              0x000000010ee53dc7 call_function + 183
61  python                              0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
62  python                              0x000000010ed168d5 function_code_fastcall + 117
63  python                              0x000000010ee53dc7 call_function + 183
64  python                              0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
65  python                              0x000000010ed168d5 function_code_fastcall + 117
66  python                              0x000000010ee53dc7 call_function + 183
67  python                              0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
68  python                              0x000000010ed168d5 function_code_fastcall + 117
69  python                              0x000000010ee53dc7 call_function + 183
70  python                              0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
71  python                              0x000000010ed168d5 function_code_fastcall + 117
72  python                              0x000000010ed98381 slot_tp_init + 193
73  python                              0x000000010eda2361 type_call + 241
74  python                              0x000000010ed16ae3 _PyObject_FastCallKeywords + 179
75  python                              0x000000010ee53ed5 call_function + 453
76  python                              0x000000010ee51aec _PyEval_EvalFrameDefault + 46092
77  python                              0x000000010ed168d5 function_code_fastcall + 117
78  python                              0x000000010ee53dc7 call_function + 183
79  python                              0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
80  python                              0x000000010ed168d5 function_code_fastcall + 117
81  python                              0x000000010ed19ce2 method_call + 130
82  python                              0x000000010ed17752 PyObject_Call + 130
83  python                              0x000000010ee51d58 _PyEval_EvalFrameDefault + 46712
84  python                              0x000000010ed168d5 function_code_fastcall + 117
85  python                              0x000000010ee53dc7 call_function + 183
86  python                              0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
87  python                              0x000000010ed168d5 function_code_fastcall + 117
88  python                              0x000000010ee53dc7 call_function + 183
89  python                              0x000000010ee51a56 _PyEval_EvalFrameDefault + 45942
90  python                              0x000000010ed168d5 function_code_fastcall + 117
91  python                              0x000000010ed19ce2 method_call + 130
92  python                              0x000000010ed17752 PyObject_Call + 130
93  python                              0x000000010ef358cb t_bootstrap + 123
94  python                              0x000000010eebc707 pythread_wrapper + 39
95  libsystem_pthread.dylib             0x00007fff57da22eb _pthread_body + 126
96  libsystem_pthread.dylib             0x00007fff57da5249 _pthread_start + 66
97  libsystem_pthread.dylib             0x00007fff57da140d thread_start + 13

)127.0.0.1 - - [05/Aug/2020 13:46:32] " /image HTTP/1.1" 200 - Assertion failed: (NSViewIsCurrentlyBuildingLayerTreeForDisplay(),= currentlyBuildingLayerTree), function NSViewSetCurrentlyBuildingLayerTreeForDisplay. file /BuildRoot/Library/Caches/com.apple.xbs/Sources/AppKit/AppKit-1671.60.107/AppKit.subproj/NSView,m. line 14221.

I am out of ideas why this is happening. I will be very grateful for any help. Thanks!

I was unable to re-create this exception, so I assume it may be something specific to your environment.

I tested this in the official python docker image, running within Docker Desktop on OSX.

That said, there are some issues with your flask code which I'll cover here. Towards the end of your image function you should probably be doing something more like:

    # ....
    ax, _ = graphic_record.plot(figure_width=10, strand_in_label_threshold=7)
 
    # This bit changes...

    output_filename = "image.png"
    output_path = os.path.join('static', output_filename)

    # The return value of this is not a filename
    image = ax.figure.savefig(output_path)

    # You should actually be passing `output_filename` to the template
    return render_template("image.html", image_filename=output_filename)

Notice here:

  • output_filename is the actual filename you want to save the image as
  • output_path is the full path static/image.png . This is only used by the savefig method to actually save the file to disk.
  • We then pass output_filename to the template as the image_filename argument which then becomes available in the template.

The template code looks like:

<img src="{{url_for('static', filename=image_filename )}}" />

Which in turn will generate the HTML:

<img src="/static/image.png" />

The technical post webpages of this site follow the CC BY-SA 4.0 protocol. If you need to reprint, please indicate the site URL or the original address.Any question please contact:yoyou2525@163.com.

 
粤ICP备18138465号  © 2020-2024 STACKOOM.COM